PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00080g00064.1
Common NameEOBII
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 176aa    MW: 19990.2 Da    PI: 5.2719
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00080g00064.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.91e-171562148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
  Peaxi162Scf00080g00064.1 15 KGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYL 62
                              79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-24765IPR009057Homeodomain-like
PROSITE profilePS5129422.0691066IPR017930Myb domain
SMARTSM007178.1E-131464IPR001005SANT/Myb domain
PfamPF002491.1E-161562IPR001005SANT/Myb domain
SuperFamilySSF466899.19E-221689IPR009057Homeodomain-like
CDDcd001675.18E-111762No hitNo description
Gene3DG3DSA:1.10.10.604.5E-86696IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MDKKPCNSQD AEVRKGPWTM EEDLILINYI ANHGEGVWNS LAKSAGLKRT GKSCRLRWLN  60
YLRPDVRRGN ITPEEQLLIM ELHAKWGNRT RIQKHIKQAE TMNGQAASSE QNDHQEACTS  120
QMSNGPNDNT IDQTYSPTSY SGNVDTFQAG PNFLTEANDN MWSMEDIWSM QLLNGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-14108922100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3608931e-147EU360893.1 Petunia x hybrida Myb-like transcription factor EOBII mRNA, complete cds.
GenBankEU3742071e-147EU374207.1 Petunia x hybrida MYB-like protein NON1 mRNA, complete cds.
GenBankJF7939191e-147JF793919.1 Petunia axillaris MYB transcription factor EOBII (EOBII) mRNA, complete cds.
GenBankJF7939201e-147JF793920.1 Petunia exserta MYB transcription factor EOBII (EOBII) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618404.11e-102PREDICTED: myb-related protein 305-like
SwissprotP813911e-84MYB05_ANTMA; Myb-related protein 305
TrEMBLF5CSS31e-126F5CSS3_9SOLA; MYB transcription factor EOBII
TrEMBLF5CSS21e-126F5CSS2_9SOLA; MYB transcription factor EOBII
TrEMBLE0CJS31e-126E0CJS3_PETHY; MYB-like protein NON1
STRINGSolyc02g067760.2.11e-94(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.12e-65myb domain protein 21
Publications ? help Back to Top
  1. Klahre U, et al.
    Pollinator choice in Petunia depends on two major genetic Loci for floral scent production.
    Curr. Biol., 2011. 21(9): p. 730-9
    [PMID:21497087]